Click here to close Hello! We notice that you are using Internet Explorer, which is not supported by Xenbase and may cause the site to display incorrectly. We suggest using a current version of Chrome, FireFox, or Safari.
Summary Images Attributions Wiki Source
XB-ANTIBODY-17326634

Antibody Name: Kcnj3 Ab1

Common Name:

RRID:
Synonyms: Kir3.1

Antigens
Gene: kcnj3

Clone Type: Polyclonal
Source: Alamone Laboratories

Antibody
Clone Number
Purification
Isotype isotype unknown
Host Organism rabbit
Xenopus Reactivity tropicalis
Non-Xenopus Reactivity human, mouse, rat
Description: The anti-GIRK1 polyclonal antibody was from Alomone Labs (Jerusalem), #APC-005. This antibody was raised against the distal C-terminal residues 437-501 of mouse GIRK1. 3ug/mL were used for Western blots.
Immunogen
Name kcnj3
Type polypeptide
Post Translational Modifications unknown post translational modifications
Source Organism rabbit
Description GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250), (MW: 34 kDa.). Intracellular, C-terminus.
Sequence
Reported Usage
western blot
Publications
First: A Quantitative Model of the GIRK1/2 Channel Reveals That Its Basal and Evoked Activities Are Controlled by Unequal Stoichiometry of Gα and Gβγ., PLoS Comput Biol 2015                    
Most recent:
View All Papers

Xenbase: The Xenopus laevis and X. tropicalis resource.
Version: 4.11.2


Major funding for Xenbase is provided by grant P41 HD064556