bbs4 Protein Sequences

Click here to close Hello! We notice that you are using Internet Explorer, which is not supported by Xenbase and may cause the site to display incorrectly. We suggest using a current version of Chrome, FireFox, or Safari.

Gene Literature (0)

Nucleotides (77)

Proteins (42)

Interactants (44)

XB-GENEPAGE- 952106

Show: All X. tropicalis X. laevis.L

Protein sequences for bbs4 - All

Models (21)

Source	Version	Model	Species
NCBI	10.1	XBmRNA29741	X. laevis.S
NCBI	10.0	mRNA019770	X. tropicalis
Xenbase	9.2	rna20970	X. laevis.S
JGI	9.1	Xelaev18020788m	X. laevis.S
Xenbase	9.1	rna22910	X. tropicalis
JGI	7.1	Xetro.G00939.1	X. tropicalis
JGI	7.1	Xetro.G00939.2	X. tropicalis
JGI	6.0	XeXenL6RMv10025764m	X. laevis.S
JGI	4.1	fgenesh1_pg.C_scaffold_103000015	X. tropicalis
ENSEMBL	4.1	ENSXETP00000011346	X. tropicalis
JGI	4.1	e_gw1.103.287.1	X. tropicalis
JGI	4.1	e_gw1.103.68.1	X. tropicalis
JGI	4.1	e_gw1.103.69.1	X. tropicalis
JGI	4.1	gw1.103.287.1	X. tropicalis
JGI	4.1	gw1.103.68.1	X. tropicalis
JGI	4.1	gw1.103.69.1	X. tropicalis
JGI	4.1	estExt_FilteredModels1.C_1030011	X. tropicalis
JGI	4.1	estExt_Genewise1.C_1030067	X. tropicalis
JGI	4.1	estExt_Genewise1.C_1030068	X. tropicalis
JGI	4.1	estExt_Genewise1.C_1030284	X. tropicalis
JGI	4.1	estExt_fgenesh1_pg.C_1030015	X. tropicalis

NCBI Proteins (21)

Accession	Species	Source
NP_001016280	X. tropicalis	RefSeq
CAJ83807	X. tropicalis	NCBI Protein
AAI57536	X. tropicalis	NCBI Protein
AAI70826	X. tropicalis	NCBI Protein
AAI70800	X. tropicalis	NCBI Protein
XP_031753789	X. tropicalis	NCBI Protein
KAE8617228	X. tropicalis	RefSeq
KAE8617227	X. tropicalis	RefSeq
KAE8617226	X. tropicalis	RefSeq
KAE8617225	X. tropicalis	RefSeq
KAE8617224	X. tropicalis	RefSeq
KAE8617223	X. tropicalis	RefSeq
KAE8617222	X. tropicalis	RefSeq
KAE8617221	X. tropicalis	RefSeq
KAE8617220	X. tropicalis	RefSeq
KAE8617219	X. tropicalis	RefSeq
XP_018111093	X. laevis.S	NCBI Protein
OCT87095	X. laevis.S	NCBI Protein

UniProt Proteins (3)

Accession	Species	Source
Q28G25 (InterPro) >Q28G25\|Swiss-Prot MTCEAEMEQIVSTALTLQEDYIKFTPRNPTMACHTEIIGVFHDIHPTVEKNKEAHRDKLVLQETLVELYSVLGIPQEPQVGKTMKFEEPEQHRGSARFDPLVNSLQLKRPLYEEERRECKRPLVQADEAVAAPSARSRRRTIYSKEQTHFLQNQFDLNPYPDFVNRCRIAKITAIPEPRIQVWFQNRRARHLPRAATSLSPQERKPPGSVGPRSSLCREAQHPEAWSEVLIPSDSQPHPN	X. tropicalis	Swiss-Prot
A0A1L8GTC8 (InterPro) >A0A1L8GTC8\|TrEMBL -	X. laevis.S	TrEMBL
A0A974HR08 (InterPro) >A0A974HR08\|TrEMBL -	X. laevis.S	TrEMBL