dlg4 Protein Sequences

Click here to close Hello! We notice that you are using Internet Explorer, which is not supported by Xenbase and may cause the site to display incorrectly. We suggest using a current version of Chrome, FireFox, or Safari.

Gene Literature (44)

Nucleotides (115)

Proteins (39)

Interactants (167)

XB-GENEPAGE- 997135

Show: All X. tropicalis X. laevis.L

Protein sequences for dlg4 - All

Models (19)

Source	Version	Model	Species
NCBI	10.1	XBmRNA32280	X. laevis.S
NCBI	10.1	XBmRNA27597	X. laevis.L
NCBI	10.0	mRNA047167	X. tropicalis
Xenbase	9.1	rna56682	X. tropicalis
JGI	7.1	Xetro.K05322.1	X. tropicalis
JGI	6.0	XeXenL6RMv10019061m	X. laevis.L
JGI	4.1	e_gw1.1129.9.1	X. tropicalis
ENSEMBL	4.1	ENSXETP00000002556	X. tropicalis
JGI	4.1	e_gw1.1129.10.1	X. tropicalis
JGI	4.1	e_gw1.1129.34.1	X. tropicalis
JGI	4.1	gw1.1129.34.1	X. tropicalis
JGI	4.1	gw1.1129.10.1	X. tropicalis
JGI	4.1	gw1.1129.9.1	X. tropicalis
JGI	4.1	estExt_FilteredModels1.C_11290001	X. tropicalis
JGI	4.1	estExt_Genewise1.C_11290009	X. tropicalis
JGI	4.1	estExt_Genewise1.C_11290010	X. tropicalis
JGI	4.1	estExt_Genewise1.C_11290034	X. tropicalis
JGI	4.1	estExt_fgenesh1_pg.C_11290001	X. tropicalis
JGI	4.1	fgenesh1_pg.C_scaffold_1129000001	X. tropicalis

NCBI Proteins (20)

Accession	Species	Source
AAI23008	X. tropicalis	NCBI Protein
AAI35455	X. tropicalis	NCBI Protein
AAI55673	X. tropicalis	NCBI Protein
XP_031754249	X. tropicalis	NCBI Protein
KAE8620719	X. tropicalis	RefSeq
KAE8620718	X. tropicalis	RefSeq
KAE8620716	X. tropicalis	RefSeq
XP_041443338	X. laevis.L	RefSeq
XP_041443337	X. laevis.L	RefSeq
XP_041444927	X. laevis.S	RefSeq
XP_041444925	X. laevis.S	RefSeq
XP_041444924	X. laevis.S	RefSeq
XP_041444923	X. laevis.S	RefSeq
XP_041444922	X. laevis.S	RefSeq
XP_018095238	X. laevis.S	RefSeq
XP_018095237	X. laevis.S	RefSeq
A0A8J0U245	X. laevis.S	Uniprot
A0A8J0U3E9	X. laevis.S	Uniprot
OCT59614	X. laevis.S	RefSeq

UniProt Proteins (3)

Accession	Species	Source
A0A8J1J8R1 (InterPro) >A0A8J1J8R1\|TrEMBL MYEKNQTWVSEIVLLGFQNLKNFKVPLFSLFLLIYIMTVCENVLIIVLVSSSRNLQSPMNSFLQQLALTDLLGSSNIVPTLLQTIIYDGVTVSLHSCIIVFNLFACSESMQCFLLAVMAYDRYVAICNPLRYTSIMNHRVCVRLILMSWALSIVITINTWSMIQTLRFCNETTIDHFFCDLTPLLELSCSNTFFVKLEITLHKVIIGITLPGYGCLVWHGLRK	X. tropicalis	TrEMBL
A0A8J0U245 (InterPro) >A0A8J0U245\|Uniprot -	X. laevis.S	Uniprot
A0A8J0U3E9 (InterPro) >A0A8J0U3E9\|Uniprot -	X. laevis.S	Uniprot